SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000224 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000224
Domain Number 1 Region: 171-453
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-77
Family Nuclear receptor ligand-binding domain 0.00000000156
Further Details:      
 
Domain Number 2 Region: 121-198
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.44e-25
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000224   Gene: ENSPPYG00000000217   Transcript: ENSPPYT00000000239
Sequence length 454
Comment pep:known chromosome:PPYG2:1:33001886:33348360:1 gene:ENSPPYG00000000217 transcript:ENSPPYT00000000239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTEGAASVHRGMKQLLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDA
SGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMP
KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACR
FMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVA
EPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSA
WMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKE
EFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLL
RQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
Download sequence
Identical sequences H2N3Q0
ENSPPYP00000000224 ENSPPYP00000000224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]