SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000406 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000406
Domain Number 1 Region: 102-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.49e-17
Family LIM domain 0.0013
Further Details:      
 
Domain Number 2 Region: 145-191
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.54e-16
Family LIM domain 0.00024
Further Details:      
 
Domain Number 3 Region: 37-83
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000178
Family LIM domain 0.00025
Further Details:      
 
Domain Number 4 Region: 9-35
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000742
Family LIM domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000406   Gene: ENSPPYG00000000361   Transcript: ENSPPYT00000000424
Sequence length 193
Comment pep:known chromosome:PPYG2:1:48824501:48852554:1 gene:ENSPPYG00000000361 transcript:ENSPPYT00000000424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKS
CYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCP
RCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGF
GFGQGAGALVHSE
Download sequence
Identical sequences H2N475 H2Q0W1 P21291
9598.ENSPTRP00000003071 9600.ENSPPYP00000000406 9606.ENSP00000345079 ENSPPYP00000000406 gi|302191613|ref|NP_001180500.1| gi|302191615|ref|NP_001180501.1| gi|4758086|ref|NP_004069.1| ENSPPYP00000000406 ENSP00000345079 ENSP00000356275 ENSP00000434147 ENSP00000436792 ENSP00000345079 NP_001180500.1.87134 NP_001180500.1.92137 NP_001180501.1.87134 NP_001180501.1.92137 NP_004069.1.87134 NP_004069.1.92137 XP_009438910.1.37143 ENSPTRP00000003071 ENSPTRP00000003071 ENSP00000345079 ENSP00000356275 ENSP00000434147 ENSP00000436792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]