SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000517 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000517
Domain Number 1 Region: 148-217
Classification Level Classification E-value
Superfamily Homeodomain-like 2.35e-20
Family Homeodomain 0.0015
Further Details:      
 
Domain Number 2 Region: 56-121
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000353
Family LIM domain 0.009
Further Details:      
 
Domain Number 3 Region: 24-55
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000214
Family LIM domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000000517
Domain Number - Region: 115-146
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0399
Family LIM domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000517   Gene: ENSPPYG00000000451   Transcript: ENSPPYT00000000538
Sequence length 390
Comment pep:known chromosome:PPYG2:1:70581801:70626785:-1 gene:ENSPPYG00000000451 transcript:ENSPPYT00000000538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQSATVPAEGAVKGLPEMLGVPMQQIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADC
QMQLADRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIIC
NRQLATGDEFYLMEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSP
KPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGGSKQ
EKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQ
DLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQTLRAMAGGPT
SDISTGSSVGYPDFPTSPGSWLDEMDHPPF
Download sequence
Identical sequences H2N4H9
ENSPPYP00000000517 9600.ENSPPYP00000000517 XP_002809779.1.23681 ENSPPYP00000000517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]