SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000557 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000557
Domain Number 1 Region: 30-128
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.14e-29
Family Ribosomal protein S14 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000557   Gene: ENSPPYG00000000485   Transcript: ENSPPYT00000000580
Sequence length 128
Comment pep:known chromosome:PPYG2:1:75928893:75938677:1 gene:ENSPPYG00000000485 transcript:ENSPPYT00000000580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAFMLCSLLRKFKQMVPSSASGQVRSHYVDWRMWRDVKKRKMAYEYADERLRINSLRKN
TILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQL
SGIQRAMW
Download sequence
Identical sequences H2N4L9
ENSPPYP00000000557 ENSPPYP00000000557 XP_002809822.1.23681 9600.ENSPPYP00000000557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]