SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000669 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000669
Domain Number 1 Region: 188-456
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.85e-84
Family Nuclear receptor ligand-binding domain 0.00000000338
Further Details:      
 
Domain Number 2 Region: 136-216
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.65e-28
Family Nuclear receptor 0.0000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000669   Gene: ENSPPYG00000000571   Transcript: ENSPPYT00000000695
Sequence length 462
Comment pep:known chromosome:PPYG2:1:85808115:85852833:1 gene:ENSPPYG00000000571 transcript:ENSPPYT00000000695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLYTCRDNKDC
LIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERILE
AELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVIL
LRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKDM
QMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
Download sequence
Identical sequences I6L535
ENSPPYP00000000669 ENSPPYP00000000669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]