SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000768 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000768
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.74e-38
Family Rhodopsin-like 0.011
Further Details:      
 
Domain Number 2 Region: 141-282
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.39e-34
Family Rhodopsin-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000768   Gene: ENSPPYG00000000659   Transcript: ENSPPYT00000000798
Sequence length 284
Comment pep:known chromosome:PPYG2:1:91966895:92050264:-1 gene:ENSPPYG00000000659 transcript:ENSPPYT00000000798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRNNHTELREFVFQGFSSFREHKLTLFVVFLTLYIFTLAGNVIIVSIISIDRHLHAPMY
FFLSMLSGSETVYTLVIIPRMLFNLIGLSQPISLVGCATQMFFFITLAINNCFLLTAMAY
DRYVAICNPLRYSVVMSKTVCMQLMKRENFTLITDFIFQGFSSFREQITLFGVFLALYIL
TLAGNIIIVTIIIDHHLHTPMYFFLRMLSTSETVYTLVILPRILSSLVGMSQPISLAGCA
TQMFFFVTFGITNCFLLTAMGYDRYVAICNPLRYMVIMNKRLRI
Download sequence
Identical sequences H2N573
9600.ENSPPYP00000000768 ENSPPYP00000000768 ENSPPYP00000000768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]