SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001063 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001063
Domain Number 1 Region: 805-832
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000428
Family A20-like zinc finger 0.019
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000001063
Domain Number - Region: 4-41
Classification Level Classification E-value
Superfamily UBA-like 0.000459
Family TAP-C domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001063   Gene: ENSPPYG00000000910   Transcript: ENSPPYT00000001098
Sequence length 843
Comment pep:known chromosome:PPYG2:1:101620343:101691404:1 gene:ENSPPYG00000000910 transcript:ENSPPYT00000001098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDVSAALSDFEQLRQVHAGNLPPSFSEGS
GGSRTPEKGFSDREPTRPSRPILQRQDDIVQEKRLSRGISHASSSIVSLARSHVSSNGGG
GGSNEHPLEMPICAFQLPDLTVYNEDFRSFIERDLIEQSMLVALEQAGRLNWWVSVDPTS
QRLLPLATTGDGNCLLHAASLGMWGFHDRDLMLRKALYALMEKGVEKEALKRRWRWQQTQ
QNKESGLVYTEDEWQKEWNELIKLASSEPRMHLGTNGANCGGVESSEEPVYESLEEFHVF
VLAHVLRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPASQCHRSPLVLAYDQAHFS
ALVSMEQKENTKEQAVIPLTDSEYKLLPLHFAVDPGKGWEWGKDDSDNVRLASVILSLEV
KLHLLHSYMNVKWIPLSSDAQAPLAQPESPTASAGDEPRSTPESGDSDKESVGSSSTSNE
GGWRKEKSKRDREKDKKKADSVANKLGSFGKTLGSKLKKNMGGLMHSKGSKPGGVGTGSG
GSSGTETLEKKKKNSLKSWKGGKEEAAGDGPVSEKPPAESVGNGGSKYSQEVMQSLSILR
TAMQGEGKFIFVGTLKMGHRHQYQEEMIQRYLSDAEERFLAEQKQKEAERKIMNGGIGGG
PPPAKKPEPDAREEQPTGPPAESRAMAFSTGYPGDFTIPRPSGGGVHCQEPRRQLAGGPC
VGGLPPYATFPRQCPPGRPYPHQDSIPSLEPGSHSKDGLHRGTLLPPPYRVADSYSNGYR
EPPEPDGWAGGLRGLPPTQTKCKQPNCSFYGHPETNNFCSCCYREELRRRERELDGELLV
HRF
Download sequence
Identical sequences H2N606
9600.ENSPPYP00000001063 ENSPPYP00000001063 XP_002810343.1.23681 ENSPPYP00000001063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]