SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001072 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001072
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily Histone-fold 1.88e-35
Family Nucleosome core histones 0.0000834
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001072   Gene: ENSPPYG00000000918   Transcript: ENSPPYT00000001107
Sequence length 77
Comment pep:known chromosome:PPYG2:1:101786701:101786931:-1 gene:ENSPPYG00000000918 transcript:ENSPPYT00000001107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT
AEILELAGNAARDNKKT
Download sequence
Identical sequences H2N614
ENSPPYP00000001072 9600.ENSPPYP00000001072 ENSPPYP00000001072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]