SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001804 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001804
Domain Number 1 Region: 80-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.84e-16
Family TRASH domain 0.0063
Further Details:      
 
Domain Number 2 Region: 897-1291
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000000019
Family Hermes transposase-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001804   Gene: ENSPPYG00000001562   Transcript: ENSPPYT00000001861
Sequence length 1325
Comment pep:known chromosome:PPYG2:1:195208566:195255349:1 gene:ENSPPYG00000001562 transcript:ENSPPYT00000001861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEPLDGECGKAVVPQQELLDKIKEEPDNAQEYGCVQQPKTQESKLKIGGVSSVNERPIA
QQLNPGFQLSFASSGPSVLLPSVPAVAIKVFCSGCKKMLYKGQTAYHKTGSTQLFCSTRC
ITRHSSPACLPPPPKKTCTNCSKDILNPKDVITTRFENSYPTKDFCSQSCLSSYELKKKP
VVTIYTKSISTKCSMCQKNADTRFEVKYQNVVHGLCSDACFSKFHSTNNLTMNCCENCGS
YCYSSSGPCQSQKVFSSTSVTAYKQNSAQIPPYALGKSLRPSAEMIETTNDSGKTELFCS
INCLSAYRVKTVTSSGVQVSCHSCKTSAIPQYHLAMSNGTIYSFCSSSCVVAFQNVFSKP
KGTNSSAVPLSQGQVVVSPPSSRSAVSIGGGNTSAVSPSSIRGSAAASLQPLAEKSQQVA
LTHTVVKLKCQHCNHLFATKPELLFYKGKMFLFCGKNCSDEYKKKNKVVAMCDYCKLQKI
IKETVRFSGVDKPFCSEVCKFLSARDFGERWGNYCKMCSYCSQTSPNLVENRLEGKLEEF
CCEDCMSKFTVLFYQMAKCDGCKRQGKLSESIKWRGNIKHFCNLFCVLEFCHQQIMNDSL
PQNKVNISKAKTAVTELPSARTDTTPVITNVVSLAKIPATLSTGNTNSVLKGAVTKEAAK
IIQDESIQADAMKFPSSQSSQPSRLLKNKGISCKPVTQTKATSCKPHTQHKECQTDLPMP
NEKNDAELDSPPSKKKRLGFFQTYDTEYLKVGFIICPGSKESSPRPQCVICGEILSSENM
KLANLSHHLKTKHSELENKPVDFFEQKSLEMECQNSSLKKCLLVEKSLVKASYLIAFQTA
ASKKPFSIAEELIKPYLVEMCSEVLGSSAGDKMKTIPLSNVTIQHRIDELSADIEDQLIQ
KVRESKWFALQIDESSEISNITLLLCYIRFIDYDCCDVKEELLFCIEMPTQITGFEIFEL
INKYIDSKSLNWKHCVGLCTDGAASMTGRYSGLKAKIQEVAMNTAAFTHCFIHRERLVAE
KLSPCLHKILLQSAQILSFIKSNALNSRMLTILCEEMGSEHVSLPLHAEVRWISRGRMLK
RLFELRHEIEIFLSQKHSDLAKYFHDEEWVAKLAYLSDIFSLINELNLSLQGTLTTFFNL
CNKIDVFKRKLKMWLKRTQENDYDMFPSFSEFSNSSGLNMTEITRIIFEHLEGLSQVFSD
CFPPEQDLRSGNLWIIHPFMNHQNNNLTDFEEEKLTQLSSDLGLQSLFKSVSVTQFWINA
KTSYPELHERAMQFLLPFSTVYLCDAAFSALTESKQKNLLGSGPALRLAVTSLIPRIEKL
VKEKE
Download sequence
Identical sequences H2N819
XP_009250957.1.23681 XP_009250965.1.23681 XP_009250970.1.23681 XP_009250975.1.23681 XP_009250978.1.23681 ENSPPYP00000001804 9600.ENSPPYP00000001804 ENSPPYP00000001804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]