SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001813 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001813
Domain Number 1 Region: 77-163
Classification Level Classification E-value
Superfamily HMG-box 5.24e-26
Family HMG-box 0.00017
Further Details:      
 
Domain Number 2 Region: 8-81
Classification Level Classification E-value
Superfamily HMG-box 2.62e-19
Family HMG-box 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001813   Gene: ENSPPYG00000001571   Transcript: ENSPPYT00000001871
Sequence length 189
Comment pep:known chromosome:PPYG2:1:196310552:196311121:-1 gene:ENSPPYG00000001571 transcript:ENSPPYT00000001871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKEIQLKPKANVSSYVHFLLNYRNKFKEQQPNTYVGFEEFSRKCSEKWRSISKHEKAKY
EALAKLDKARYQEEMMNYVGKTKKRRKRDPQAPRRPPSSFLLFCQDHYAQLKRENPNWSV
VQVAKATGKMWSAATDLEKHPYEQRAALLRAKYFEELELYRKQRKQCNARKKYRMSARNR
CRGKRVRQS
Download sequence
Identical sequences H2N828
9600.ENSPPYP00000001813 XP_002811141.1.23681 ENSPPYP00000001813 ENSPPYP00000001813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]