SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002131 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002131
Domain Number 1 Region: 213-274
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000143
Family LIM domain 0.0078
Further Details:      
 
Domain Number 2 Region: 271-337
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000495
Family LIM domain 0.028
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000002131
Domain Number - Region: 182-211
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000812
Family LIM domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002131   Gene: ENSPPYG00000001837   Transcript: ENSPPYT00000002195
Sequence length 338
Comment pep:known chromosome:PPYG2:1:214677627:214698557:-1 gene:ENSPPYG00000001837 transcript:ENSPPYT00000002195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKPEKRVASSVFITLAPPRRDVAVAEEVRQAVCEARRGRPWEAPAPMKTPEAGLEGRP
SPWTPPGRAAATVPAAPMQLSNGGCPPPPPVLDGEDALPDLDLLPPPPPPPPVLLPSEEE
APASMGASLIADLEQLHLSPPLPPPPPQAPAERPSVQPSPLRPVEEELPPPPAERVEKGA
STDICAFCHKTVSPRELAVEAMKRQYHAQCFTCRTCRRQLAGQSFYQKDGRPLCEPCYQD
TLERCGKCGEVVRDHIIRALGQAFHPSCFTCVTCARCIGDESFALGSQNEVYCLDDFYRK
FAPVCSICENPIIPRDGKDAFKIECMGRSFHENCYRCE
Download sequence
Identical sequences H2N8Y8
9600.ENSPPYP00000002131 ENSPPYP00000002131 ENSPPYP00000002131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]