SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002245 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002245
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.14e-21
Family THAP domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002245   Gene: ENSPPYG00000001935   Transcript: ENSPPYT00000002312
Sequence length 239
Comment pep:known chromosome:PPYG2:1:223876844:223884809:-1 gene:ENSPPYG00000001935 transcript:ENSPPYT00000002312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKSCAARQCCNRYSSRRKQLTFHRFPFSRPELLKEWVLNIGRGNFKPKQHTVICSEHFR
PECFSAFGNRKNLKHNAVPTVFAFQDPTQQVRENTDPASERGNASSSQKEKVLPEGGAGE
DSPGRNMDTALEELQLPPNAEDPVKQVSPRRPQATEAVGQPTGPAGLRRPPNKQPSDHSY
ALLDLDSLKKKLFLTLKENEKLRKRLQAQRLVMRRMSSRLRACKGHRGLRARLGPEQQS
Download sequence
Identical sequences H2N9A0
ENSPPYP00000002245 9600.ENSPPYP00000002245 XP_009233908.1.23681 ENSPPYP00000002245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]