SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002408 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002408
Domain Number 1 Region: 311-370
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.55e-18
Family Erythroid transcription factor GATA-1 0.00017
Further Details:      
 
Domain Number 2 Region: 257-309
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.76e-16
Family Erythroid transcription factor GATA-1 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002408   Gene: ENSPPYG00000002079   Transcript: ENSPPYT00000002482
Sequence length 444
Comment pep:known chromosome:PPYG2:10:8388745:8409815:1 gene:ENSPPYG00000002079 transcript:ENSPPYT00000002482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLGHSYMDAAQYPLPEEVDVLFNIDGQGNHV
PPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT
SIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE
KECLKYQVPLPDSMKLESSHSRGSMTALGGASSSAHHPITTYPPYVPEYSSGLFPPSSLL
GGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRP
LIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKE
GIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTP
TPMHPPSSLSFAPHHPSSMVTAMG
Download sequence
Identical sequences H2N9Q8
9600.ENSPPYP00000002408 ENSPPYP00000002408 XP_002820561.1.23681 XP_009243388.1.23681 ENSPPYP00000002408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]