SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002539 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002539
Domain Number 1 Region: 66-192
Classification Level Classification E-value
Superfamily Lysozyme-like 3.49e-47
Family C-type lysozyme 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002539   Gene: ENSPPYG00000002180   Transcript: ENSPPYT00000002614
Sequence length 195
Comment pep:known chromosome:PPYG2:10:30470390:30491388:1 gene:ENSPPYG00000002180 transcript:ENSPPYT00000002614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDTHLSCLSPTKWSSVSSTDSTEKSASGAGTRNLPFQFCLRQALRMKAVGILTLIGCLV
TGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGI
FQINSFAWCRRGKLKENNYCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCE
GRDLSEWKKGCEVVS
Download sequence
Identical sequences H2NA30
9600.ENSPPYP00000002539 ENSPPYP00000002539 XP_002820673.1.23681 ENSPPYP00000002539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]