SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002546 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002546
Domain Number 1 Region: 66-192
Classification Level Classification E-value
Superfamily Lysozyme-like 6.17e-48
Family C-type lysozyme 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002546   Gene: ENSPPYG00000002186   Transcript: ENSPPYT00000002621
Sequence length 194
Comment pep:known chromosome:PPYG2:10:31603439:31621815:-1 gene:ENSPPYG00000002186 transcript:ENSPPYT00000002621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDAHLSCQSPTKWSGVSSTDSTEKSASGAGTMNLPFQFCLRQALRMKAVGILTLIGCLV
TGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGI
FQINSFVWCRRGKLKENNHCHVACSALITDDLTDAIICAKKIVKETQGMNYWQGWKKHCE
GRDLSDWKKSCEVS
Download sequence
Identical sequences H2NA37
ENSPPYP00000002546 9600.ENSPPYP00000002546 ENSPPYP00000002546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]