SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002549 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002549
Domain Number 1 Region: 927-979
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 239-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000255
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 3 Region: 900-935
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000438
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 171-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000023
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 5 Region: 594-641
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000813
Family Homeodomain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002549   Gene: ENSPPYG00000002189   Transcript: ENSPPYT00000002625
Sequence length 1125
Comment pep:known chromosome:PPYG2:10:32366560:32565686:1 gene:ENSPPYG00000002189 transcript:ENSPPYT00000002625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDD
LPTDQTVLPGRSSEREGNAKNCWEDDTGKEGQEILGPEAQADEAGCTVKDDECESDAENE
QNHDPNVEEFLQQQDTAVIFPEAPEEDQRQGTPEASGHDENGTPDAFSQLLTCPYCDRGY
KRFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRK
FKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVN
GRPRTGLKTSQCSSPSLSASPGSPTRPQIRQKIENKPLQEQLSVNQIKTEPVDYEFKPIV
VASGINCSTPLQNGVFTGGGPLQATSSPQGVVQAVVLPTVGLVSPISINLSDIQNVLKVA
VDGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSL
EQPSQLQVVPQNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPG
DINALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAY
YALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNN
DQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGY
LYTAEGAQEEPQVEPLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNLSCTKKEPQK
DSCVTDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIP
QVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKT
ENGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKP
YQCDKCGKRFSHSGSYSQHMNHRYSYCKREAEERDSTEQEEAGPEILSNEHVGARASPSQ
GDSDERESLTREEDEDSEKEEEEEDKEMEELQEEKECEKPQGDEEEEEEEEEVEEEEVEE
AENEGEEAKTEGLMKDDRAESQASSLEQKVSESSEQVSEEKTNEA
Download sequence
Identical sequences H2NA40
ENSPPYP00000002549 9600.ENSPPYP00000002549 ENSPPYP00000002549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]