SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002790 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002790
Domain Number 1 Region: 55-257
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.1e-61
Family alpha-catenin/vinculin 0.00000422
Further Details:      
 
Domain Number 2 Region: 663-851
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.65e-56
Family alpha-catenin/vinculin 0.00035
Further Details:      
 
Domain Number 3 Region: 503-626
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.08e-53
Family alpha-catenin/vinculin 0.00000695
Further Details:      
 
Domain Number 4 Region: 372-501
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.22e-40
Family alpha-catenin/vinculin 0.00000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002790   Gene: ENSPPYG00000002404   Transcript: ENSPPYT00000002885
Sequence length 895
Comment pep:known chromosome:PPYG2:10:67925908:69734639:1 gene:ENSPPYG00000002404 transcript:ENSPPYT00000002885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAETPITLNIDPQDLQVQTFTVEKLLEPLIIQVTTLVNCPQNPSSRKKGRSKRASVLLA
SVEEATWNLLDKGEKIAQEATVLKDELTASLEEVRKESEALKVSAERFTDDPCFLPKREA
VVQAARALLAAVTRLLILADMIDVMCLLQHVSAFQRTFESLKNVANKSDLQKTYQKLGKE
LENLDYLAFKRQQDLKSPNQRDEIAGARASLKENSPLLHSICSACLEHSDVASLKASKDT
VCEEIQNALNVISNASQGIQNMATPPEPQAATLGSALDELENLIVLNPLTVTEEEIRPSL
EKRLEAIISGAALLADSSCTRDFHRERIIAECNAIRQALQDLLSEYMNNAGKKERSNTLN
IALDNMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEIKEYAAIFHE
HTSRLVEVANLACSMSTNEDGIKIVKIAANHLETLCPQIINAALALAARPKSQVVKNTME
MYKRTWENHIHVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDVDNLDRAAGAI
RGRAARVAHIVTGEMDSYEPGAYTEGVMRNVNFLTSTVIPEFVTQVNVALEALSKNSLNV
LDDNQFVDISKKIYDTIHDIRCSFRMIRTPEELEDVSDLEEEHEVRSHTSIQTEGKTDRA
KMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKNMCMIMMEMTDFTR
GKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLEQIKFYSHQLK
ICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAG
PRHPVVMWRMKAPAKKPLIKREKPEETCAAVRRGSAKKKIHPLQVMSEFRGRQIY
Download sequence
Identical sequences H2NAS1
ENSPPYP00000002790 ENSPPYP00000002790 9600.ENSPPYP00000002790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]