SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002818 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002818
Domain Number 1 Region: 182-271
Classification Level Classification E-value
Superfamily HMG-box 2.36e-22
Family HMG-box 0.0025
Further Details:      
 
Domain Number 2 Region: 87-173
Classification Level Classification E-value
Superfamily HMG-box 6.28e-22
Family HMG-box 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002818   Gene: ENSPPYG00000002430   Transcript: ENSPPYT00000002918
Sequence length 284
Comment pep:known chromosome:PPYG2:10:77480924:77492137:-1 gene:ENSPPYG00000002430 transcript:ENSPPYT00000002918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITHAVGSQAVPVVIAGVVYCQEALRDWGRVTASSAGAMAFLRSMWGVLSALGRSGAELC
TGCGSRLRSPFSFVYLPRWFSSVLASCPKKPISSYLRFSKEQLPIFKAQNPDAKTTELIR
RIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEITDKHLKRKA
MAKKKELTLLGKPKRPRSAYNVYVAERFQEVQGDSPQEKLKTLKENWKNLSDSEKELYIQ
YAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTMKQRRKYGAEEC
Download sequence
Identical sequences Q5REW5
NP_001124767.1.23681 9600.ENSPPYP00000002819 ENSPPYP00000002818 ENSPPYP00000002818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]