SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003105 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003105
Domain Number 1 Region: 4-31
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000321
Family LASP-1 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000003105
Domain Number - Region: 32-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0402
Family LIM domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003105   Gene: ENSPPYG00000002663   Transcript: ENSPPYT00000003211
Sequence length 1729
Comment pep:known chromosome:PPYG2:10:112969023:113048405:-1 gene:ENSPPYG00000002663 transcript:ENSPPYT00000003211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVQACSRCGYGVYPAEKISCIDQIWHKACFHCEVCKMMLSVNNFVSHQKKPYCHAHNPK
NNTFTSVYHTPLNLNVRTFPEAISGIHDQEDGEQFKSVFHWDMKSKDKEGAPNRQPLANE
RAYWTGYGEGNAWCPGALPDPEIVRMVEARKSLGEEYTEDYEQPRGKGSFPAMITPAYQR
AKKANQLASQVEYKRGHDDRISRFSTVADTPELLRSKAGAQLQSDVRYTEDYEPQRGKGS
FPAMITPAYQIAKRANELASDVRYHQQYQKEMRGMSGPAIGAEGTLTRECADQYGQGYPE
EYEEHRGKGSFPAMITPAYQNAIKYRQDFNKMKGAAHYHSLPAQDNLVLKRAQSVNKLVS
EVEYKKDLESSRGHSINYCETPQFRNVSKISKFTSDNKYKENYQNHMRGRYEGVGMDRRT
LHAMKVGSLASNVAYKADYKHDIVDYNYPATLTPSYQTTMKLVPLKDANYRQSIDKLKYS
SVTDTPQIVQAKINAQQLSHVNYRSDYEKNKLNYTLPQDVPQLVKAKTNAKLFSEVKYKE
GWEKTKGKGFEMKLDAMSLLAAKASGELASNVDLLLSLKIKYKEEYEKTKGKAMGTADSR
LLHSLQIAKMSSEVEYKKGFEESKTRFHLPMDMVNIRHAKKAQALASDLDYRKKLHEYTV
LPEDMKTQWAKKAYGLQSELRYKADLAWMKGVGWLTEGSLNLEQAKKAGQLVSEKNYRQR
VDELKFTSVTDSSQMEHAKKSQELQSGVAYKAGNEQSVHQYTISKDEPLFLQARANAANL
SEKLYKSSWENQKAKGFELRLDSLTFLAAKAKRDLASEVKYKEDYERSRGKLIGAKDVQG
DSQMSHSLQMSKLQSELEYKKGFEDTKSQCHISLDMVHLVHARKAQHLATDIGYKTAAHH
FTALPTDMKVEWAKKAYGLQSDNQYRADVKWMKGTGWVATGSLNVEQAKKAGELISEKKY
RQHPDALKFTSIKDTPEMVQARISYTQAVDRLYREQGENIKHHYTPTADLPEVLLAKLNA
MNISETRYKESWSKLRDGGYKLRLDAIPFQAAKASGEIISDYKYKEAFEKMKGQMLGSRS
LEDDISLAHSVYATSLQSDVNYKKGFEHSKAQFHLPLDMAALVHAKKAQTLASDQDYKHP
LPQYTSLAEDLRLSCAKKAHKLQSENLYRSDLNFMRGVACVIPGTLEIEGRKKASELISE
SKYRQHPHSFKYTAVTDTPNLLHAKFSNQITNERLYKAAGEDARHQYTMTLGLPEFIRAK
TNAANLSDAKYKESWRNLRAQGYKLTIEALPFQAARASGDIASDFLYRHDFVKERGKLIG
PQSVRDDPRIQHCRRMGQLQSELQYRRGATSSQAQFHLPMDMVHLVHAKNAQALASDHDY
RTQYHEFTALPEDLKMAWAKKAHALQSELRYKSDLIGMKGIGWLALRSPQIESAKKAGEL
ISETKYRKKPDSIKFTTVVDSPDLVHAKNSYMHCNERMYRSGDAESLHRYTLIPDHPDFT
RARLNALHLSDKVYRNSWEQTRAGSYDFRLDAIPFQTARASREIASDFRYKEAFLRDRGL
QIGYRSVDDDPRMKHFLNVGRLQSDNEYKKDFAKSRSQFHSSTDQPGLLQAKRSQQLASD
VHYRQPLPQPTCDPEQLGLRHAQKAHQLQSDVKYKSDLNLTRGVGWTPPGSYKVEMARRA
AELANARGLCLQGAYRGAEAVEAGDHQSGEVNPDATEILHVKRKKALLL
Download sequence
Identical sequences H2NBM5
9600.ENSPPYP00000003104 ENSPPYP00000003104 ENSPPYP00000003105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]