SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003121 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003121
Domain Number 1 Region: 693-771
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 1.31e-26
Family VHP, Villin headpiece domain 0.0000829
Further Details:      
 
Domain Number 2 Region: 175-238
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.81e-17
Family LIM domain 0.0035
Further Details:      
 
Domain Number 3 Region: 48-111
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.97e-16
Family LIM domain 0.0023
Further Details:      
 
Domain Number 4 Region: 105-141
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000048
Family LIM domain 0.0015
Further Details:      
 
Domain Number 5 Region: 234-267
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000103
Family LIM domain 0.0021
Further Details:      
 
Domain Number 6 Region: 147-174
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000263
Family LIM domain 0.01
Further Details:      
 
Domain Number 7 Region: 10-46
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000045
Family LIM domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003121   Gene: ENSPPYG00000002674   Transcript: ENSPPYT00000003227
Sequence length 771
Comment pep:novel chromosome:PPYG2:10:113847927:114190880:-1 gene:ENSPPYG00000002674 transcript:ENSPPYT00000003227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSARVAHPQDPHHPSEKPVIHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGF
FIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRV
TFNGRDCLCQLCAQPMSSSPKETTFSSNCAGCGRDIKNGQALLALDKQWHLGCFKCKSCG
KVLTGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQM
FTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPPNIRRSSSDFFYPKSLIRRTGRSPSLQPT
RTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPF
YTSGYDDKQERQSLGESPRTLSPTPSAEGYQDVRDRMIQRSTSQGSINSPVYSRHSYTPT
TSRSPQHFHRPELLSPGVQRLSYLRTSSLSPTHSDSRPNPPFRHHFIPHIKGNEPSSGRN
SPLPYRPDSRPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQHDAAALAAQSKSSEDIIKF
SKFPAAQAPDPSETPKIETDHWPGPPSFAAVGPDMKRRSSGREEDDEELLRRRQLQEEQL
MKLNSGLGQLILKEEMEKESRERSSLLASRYDSPINSASHIPSSKTASLPGYGRNGLHRP
VSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRG
RNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF
Download sequence
Identical sequences H2NBP2
ENSPPYP00000003121 ENSPPYP00000003121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]