SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003370 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003370
Domain Number 1 Region: 51-172
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.62e-21
Family Synaptotagmin-like (S variant) 0.041
Further Details:      
 
Domain Number 2 Region: 221-271
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000791
Family CUE domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003370   Gene: ENSPPYG00000002898   Transcript: ENSPPYT00000003486
Sequence length 274
Comment pep:known chromosome:PPYG2:11:1059244:1100355:-1 gene:ENSPPYG00000002898 transcript:ENSPPYT00000003486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVGTVGRLNITVV
QAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIF
DERAFSMDDRIAWTHITIPESLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMV
MPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKAIQDM
FPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEP
Download sequence
Identical sequences A0A096MQQ9 A0A0D9RC57 A0A2K5LQG9 A0A2K6R0T7 G1RRS4 H2NCD6 Q6FIE9 Q9H0E2
ENSP00000263646 ENSPPYP00000003370 9600.ENSPPYP00000003370 9606.ENSP00000314733 gi|21361619|ref|NP_061882.2| ENSP00000314733 ENSNLEP00000015942 NP_061882.2.87134 NP_061882.2.92137 XP_002821400.1.23681 XP_003281379.1.23891 XP_007996532.1.81039 XP_010385102.1.97406 XP_011896491.1.92194 ENSPPYP00000003370 GO.38771 HR4420 ENSPANP00000002093 ENSNLEP00000015942 ENSP00000314733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]