SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003544 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000003544
Domain Number - Region: 42-74
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0741
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003544   Gene: ENSPPYG00000003062   Transcript: ENSPPYT00000003671
Sequence length 199
Comment pep:known chromosome:PPYG2:11:10338320:10339563:-1 gene:ENSPPYG00000003062 transcript:ENSPPYT00000003671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNGAEVDDFSWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGETCADCGTIL
LQDKQRKIYCVACQELDSDVDKDNPALNAQAALSQAREHQLASASELPLGSRPASQPPVP
RPEHCEGAAAGLKAAQGPPAPAVPPNTDVMACTQTALLQKLTWASAELGSSTSLETSIQL
CGLIRACAEALRSLQQLQH
Download sequence
Identical sequences H2NCV6
9600.ENSPPYP00000003544 ENSPPYP00000003544 XP_002821540.2.23681 ENSPPYP00000003544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]