SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003651 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003651
Domain Number 1 Region: 266-318
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000418
Family Myb/SANT domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000003651
Domain Number - Region: 362-405
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00257
Family Erythroid transcription factor GATA-1 0.039
Further Details:      
 
Domain Number - Region: 7-138
Classification Level Classification E-value
Superfamily BAH domain 0.00458
Family BAH domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003651   Gene: ENSPPYG00000003161   Transcript: ENSPPYT00000003780
Sequence length 668
Comment pep:known chromosome:PPYG2:11:13573931:13581527:1 gene:ENSPPYG00000003161 transcript:ENSPPYT00000003780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLAD
SNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQY
LEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLAEGESDHRNQQKMEMKVWD
PDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQR
NGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSL
ASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAG
FQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGATRGTTEP
HSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLARRMCRDLLQPRRAAR
RPYAPINANAIKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKT
PINRNQLSQNRGLGSIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPAD
APNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLIAVRPPVPLPAPSHPAST
NEPIVLED
Download sequence
Identical sequences H2ND56
XP_009244519.1.23681 ENSPPYP00000003651 9600.ENSPPYP00000003651 ENSPPYP00000003651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]