SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003734 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003734
Domain Number 1 Region: 178-240
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.77e-20
Family LIM domain 0.0078
Further Details:      
 
Domain Number 2 Region: 237-299
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.98e-19
Family LIM domain 0.00077
Further Details:      
 
Domain Number 3 Region: 296-346
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000039
Family LIM domain 0.00086
Further Details:      
 
Domain Number 4 Region: 151-182
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000186
Family LIM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003734   Gene: ENSPPYG00000003248   Transcript: ENSPPYT00000003871
Sequence length 351
Comment pep:novel chromosome:PPYG2:11:18248023:18311978:1 gene:ENSPPYG00000003248 transcript:ENSPPYT00000003871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKESNRDETSEILSVQDNTSPLLAQL
VYTTNIQELNVYSEAQEPKKSPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGRKHLPD
KQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTH
CKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHC
GEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCF
TSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCITAMGLQKVQC
Download sequence
Identical sequences H2NDD6
ENSPPYP00000003734 ENSPPYP00000003734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]