SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003868 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003868
Domain Number 1 Region: 126-194
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000105
Family LIM domain 0.0018
Further Details:      
 
Domain Number 2 Region: 94-124
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000261
Family LIM domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000003868
Domain Number - Region: 191-216
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000822
Family LIM domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003868   Gene: ENSPPYG00000003368   Transcript: ENSPPYT00000004016
Sequence length 227
Comment pep:known chromosome:PPYG2:11:35471653:35483385:1 gene:ENSPPYG00000003368 transcript:ENSPPYT00000004016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGSAVTVLERGGASSPPERRSKRRRRSGGGGGGGGSARAPEGVRAPAAGQPRATKGAPP
PPGTPPPSPMSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWH
EDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVK
DKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI
Download sequence
Identical sequences H2NDR0
ENSPPYP00000003868 XP_002821941.1.23681 ENSPPYP00000003868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]