SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003932 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003932
Domain Number 1 Region: 143-184
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.36e-16
Family LIM domain 0.0068
Further Details:      
 
Domain Number 2 Region: 76-122
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000589
Family LIM domain 0.00072
Further Details:      
 
Domain Number 3 Region: 185-227
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000307
Family LIM domain 0.0011
Further Details:      
 
Domain Number 4 Region: 48-74
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000022
Family LIM domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003932   Gene: ENSPPYG00000003425   Transcript: ENSPPYT00000004080
Sequence length 233
Comment pep:novel chromosome:PPYG2:11:50913827:50927496:1 gene:ENSPPYG00000003425 transcript:ENSPPYT00000004080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTFPSSEMELSIINRILTDFYFKCQVLMILDLDQIVFKMPNWGGGAKCGACEKTVYHAE
EIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGRRYGPKGIGYGQGAGCLS
TDTGEHLGLQFQQSPKPARSATTSNPSKFTAKFGESEKCPRCGKSVYAAEKVMGGGKPWH
KTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTQQVEKKE
Download sequence
Identical sequences H2NDW9
ENSPPYP00000003932 ENSPPYP00000003932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]