SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004025 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004025
Domain Number 1 Region: 121-150
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000376
Family LIM domain 0.01
Further Details:      
 
Domain Number 2 Region: 85-117
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000261
Family LIM domain 0.0034
Further Details:      
 
Domain Number 3 Region: 57-85
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000939
Family LIM domain 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000004025
Domain Number - Region: 151-182
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00125
Family LIM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004025   Gene: ENSPPYG00000003508   Transcript: ENSPPYT00000004181
Sequence length 192
Comment pep:known chromosome:PPYG2:11:62030264:62069768:1 gene:ENSPPYG00000003508 transcript:ENSPPYT00000004181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEPASCPRTGRPAKARPESAPFSRPSLAAAGHGAPEMMVLDKEDGVPMLSVQPKGKQKGC
AGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGT
TGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEE
GQLNGTFESQVQ
Download sequence
Identical sequences H2NE61
9598.ENSPTRP00000005817 9600.ENSPPYP00000004025 ENSPPYP00000004025 ENSPPYP00000004025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]