SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004225 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004225
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.57e-18
Family THAP domain 0.00056
Further Details:      
 
Domain Number 2 Region: 249-529,581-729
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000834
Family Hermes transposase-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004225   Gene: ENSPPYG00000003697   Transcript: ENSPPYT00000004397
Sequence length 761
Comment pep:known chromosome:PPYG2:11:71816259:71847787:-1 gene:ENSPPYG00000003697 transcript:ENSPPYT00000004397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNFCAAPNCTRKSTQSDLAFFRFPRDPARCQKWVENCRRADLEDKTPDQLNKHYRLCAK
HFETSMICRTSPYRTVLRDNAIPTIFDLTSHLNNPHSRHRKRIKELSEDEIRTLKQKKID
ETSEQEQKHKETNNSNAQNPSEEEGEGQDEDILPLTLEEKENKEYLKSLFEILILMGKQN
IPLDGHEADEIPEGLFTPDNFQALLECRINSGEEVLRKRFETTAVNTLFCSKTQQRQMLE
ICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDESHNLREEFIGFLPYE
ADAEILAVKFHTMITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAIYTLCS
SCALNMWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLELDNVISVLFQNSKERGKELK
EICHSQWTGRHDAFEILVELLQALVLCLDGINSDTNIRWNNCIAGRAFVLCSAVTDFDFI
VTIVVLKNVLSFTRAFGKNLQGQTSDVFFAAGSLTAVLHSLNEVMENIEVYHEFWFEEAT
NLATKLDIQMKLPGKFRRAHQGNLESQLTSESYYKETLSVPTVEHIIQELKDIFSEQHLK
ALKCLSLVPSVMGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPS
TIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNL
ALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT
Download sequence
Identical sequences H2NEQ2
ENSPPYP00000004225 9600.ENSPPYP00000004225 XP_002822308.1.23681 ENSPPYP00000004225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]