SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004254 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004254
Domain Number 1 Region: 43-132
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.88e-29
Family SCAN domain 0.0001
Further Details:      
 
Domain Number 2 Region: 328-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-20
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 3 Region: 285-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 369-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.38e-17
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 200-246
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000235
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004254   Gene: ENSPPYG00000003724   Transcript: ENSPPYT00000004427
Sequence length 425
Comment pep:known chromosome:PPYG2:11:73900925:73902420:1 gene:ENSPPYG00000003724 transcript:ENSPPYT00000004427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMRELKADACLNSHMGAMWETNRSVKENSSQSKKYSTQIENLGPGSARRHFRSFHYHEA
TEPLEAINQLQKLCHHWLRPEIHSKHILEMLVLEQFLTILPKGTQHWVQKHHPQHVKQAL
VLVECLQREPGGTKNEVTAHELGEEAVLLGGTTVAPGFKWKAAELEPMERILEYIQILAL
SEHKSTEDWKMASKLIWPESQSLLTFEDMAAYFSEEEWQLLDPLEKTVYNDVMQAIYETA
ICLGKQRAGKIIGTKMASSFSKEEKKLTTCKQELPKLMDLHGKGHTGEKPFKCQDCGKIF
RVSSDLTKHQRIHTEEKLYKCQQCDRRFRWSSGLNKHFMTHQGINPYRCSWCGKSFSYDT
NLQTHQRIHTGEKPFKCHECEKIFIHKSHLIKYQITHTGEQPYTCSICRRNFSRQLSLLR
HQKLH
Download sequence
Identical sequences H2NET0
ENSPPYP00000004254 9600.ENSPPYP00000004254 ENSPPYP00000004254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]