SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004346 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004346
Domain Number 1 Region: 619-645,676-915
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.15e-62
Family Nuclear receptor ligand-binding domain 0.00000000126
Further Details:      
 
Domain Number 2 Region: 566-643
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-23
Family Nuclear receptor 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004346   Gene: ENSPPYG00000003801   Transcript: ENSPPYT00000004521
Sequence length 935
Comment pep:known chromosome:PPYG2:11:97347931:97437721:-1 gene:ENSPPYG00000003801 transcript:ENSPPYT00000004521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAVGPFPGSQTSDTLPEVSAIPISLDGLLF
PRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEAKRGAGGSSSSPPEKDSGLLDSVLDTLLA
PSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQGVLSPLMSRSGGKAGDSSGTAA
AHKVLPRGLSPSRQLLLPASGSPHWSGAPVKPSPQPAAVEVEEEDGSESEDSAGPLLKGK
PRALGGAAAGGGAAAVPPGVAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTV
MDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPSASSTPVAVGDFPD
CAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLG
PPPPLPPRAPPTRAGEAAVTAAPASASVSSASSSGSTLECILYKAQGAPPQQGPFAPPPC
KAPGVSGCLLPRDGLPSTSASAAAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVY
PPYLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQ
HNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVVRALDAVALPQ
PVGIPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSL
NQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYF
APDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQ
TQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQS
RALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
Download sequence
Identical sequences H2NF18
ENSPPYP00000004346 XP_002822433.1.23681 9600.ENSPPYP00000004346 ENSPPYP00000004346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]