SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004475 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004475
Domain Number 1 Region: 4-105
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.53e-32
Family Proprotein convertase P-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004475   Gene: ENSPPYG00000003906   Transcript: ENSPPYT00000004651
Sequence length 183
Comment pep:novel chromosome:PPYG2:11:114041600:114044977:1 gene:ENSPPYG00000003906 transcript:ENSPPYT00000004651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLEMSGLKTLEHVAVTVSIAHPRRGSLELKLFCPSGMMSLIGAPRSMDSDPNGFNDWTF
STVRCWGERARGTYRLVIRDVGDESFQVGILRQWQLTLYGSVWSPVDIRDRQRLLESAMS
GRYLHDDFALPCPPGLKIPEEDGYTITPNTLKTLVLVGCFTVFWTVYYMLEVYLSQRNVA
SNQ
Download sequence
Identical sequences H2NFE2
ENSPPYP00000004475 ENSPPYP00000004475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]