SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004660 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004660
Domain Number 1 Region: 169-308
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.94e-27
Family Beta-galactosidase LacA, domains 4 and 5 0.026
Further Details:      
 
Domain Number 2 Region: 1-51
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000000000484
Family Glycosyl hydrolases family 35 catalytic domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004660   Gene: ENSPPYG00000004082   Transcript: ENSPPYT00000004845
Sequence length 314
Comment pep:known chromosome:PPYG2:11:131414773:131424642:1 gene:ENSPPYG00000004082 transcript:ENSPPYT00000004845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGGTNFGFMNGATYFGEHTSIVTSYDYDAVLTEAGDYTEKYFKLQKLFQSVSATPLPR
VPQLTPKAVYPRMRPSLYLPLWDALSYLNEPVRSRQPVNMENLPINHGSGQSYGLVLYEK
SICSGGRLRAQAHDMAQVFLDETMIGILNDNNEDLHIPELRDCRYLRILVENQGRVNFSW
QIQNEQKGITGSVSINDSSLEGFTIYSLEMKMSFFERLRSATWKPVPDSHQGPAFYRGTL
KAGPSPKDTFLSLLNWNYGFVFINGRNLGRYWNIGPQKTLYLPGAWLHPEDNEVILFEKM
MSGSDIKSTDKPML
Download sequence
Identical sequences H2NFX5
9600.ENSPPYP00000004660 ENSPPYP00000004660 XP_002822770.2.23681 ENSPPYP00000004660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]