SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005148 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005148
Domain Number 1 Region: 416-456
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000401
Family LIM domain 0.00027
Further Details:      
 
Domain Number 2 Region: 382-415
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000772
Family LIM domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005148   Gene: ENSPPYG00000004510   Transcript: ENSPPYT00000005349
Sequence length 760
Comment pep:known chromosome:PPYG2:12:49853940:49965794:-1 gene:ENSPPYG00000004510 transcript:ENSPPYT00000005349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESTPFNRRQWTSLSLRVTAKELSLVNKNKSSAIVEIFSKYQKAAEETNMEKKRSNTENL
SQHFRKGTLTVLKKKWENPGLGAESHTDSLRNSSTEIRHRVDHPPAEVTSHAASGTKADQ
EEQIHPRSRLRSPPEAFIQGRYSHIKDGEDLKDHSTKSKKMENCLGESRHEVEKSEISEN
TEASGKIEKYNVPLNRLKMMFEKGEPTQTKILRAQSRSASGRKNSENSYSLDDLEIGPGQ
LPSSTFDSEKNESRRNLELPRLSETSIKDRMAKYQAAVSKQSSSTNYTNELKASGGEIKI
HKMEQKENVPPGPEVCITHQEGEKISTNENSLAVRSTPAEDDSRDSQVKSEVQQPVHPKP
LSPDSRASSLSESSPPKAIKKFQAPARETCVECQKTVYPMERLLANQQVFHISCFRCSYC
NNKLSLGTYASLHGRIYCKPHFNQLFKSKGNYDEGFGHRPHKDLWASKNENEEILERPAQ
LANARETPHSPGVEDAPIAKVGVLAASMEAKASSQQEKEDKPAETKKLRIAWPPPTELGS
SGSTLEEGIKVSKPKWPPEDEISKPEVPEDVDLDLKKLRRSSSLKERSRPFTVAASLQST
SVKSPKTVSPSTRKGWSMSEQSEESVGGRVAERKQVENAKASKKNGSVGKTTWQNKESKG
GETGKRSKEGHSLEMENENLVENGAHSDEDDNSFLKQQSPQEPKSPNWLSFVDNTFAEEF
TTQNQKSQDVELWEGEVVKELSVEEQIKRNRYYDEDEDEE
Download sequence
Identical sequences H2NH97
9600.ENSPPYP00000005148 XP_002823268.1.23681 ENSPPYP00000005148 ENSPPYP00000005148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]