SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005215 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005215
Domain Number 1 Region: 156-432
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.39e-77
Family Nuclear receptor ligand-binding domain 0.00000000122
Further Details:      
 
Domain Number 2 Region: 86-185
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.36e-18
Family Nuclear receptor 0.0000771
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005215   Gene: ENSPPYG00000004572   Transcript: ENSPPYT00000005418
Sequence length 469
Comment pep:novel chromosome:PPYG2:12:52983406:53005307:-1 gene:ENSPPYG00000004572 transcript:ENSPPYT00000005418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS
LSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIRD
MVYTCHATNCIITVTXXXXXXXXXXXXXXXXXXXXXXQYCRLQKCFEVGMSKEAVRNDRN
KKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLG
LWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDT
MTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLE
EPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIP
GPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
Download sequence
Identical sequences H2NHG3
ENSPPYP00000005215 ENSPPYP00000005215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]