SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005460 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005460
Domain Number 1 Region: 102-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.33e-16
Family LIM domain 0.0024
Further Details:      
 
Domain Number 2 Region: 37-83
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.83e-16
Family LIM domain 0.00038
Further Details:      
 
Domain Number 3 Region: 145-190
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000124
Family LIM domain 0.00037
Further Details:      
 
Domain Number 4 Region: 8-35
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000205
Family LIM domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005460   Gene: ENSPPYG00000004790   Transcript: ENSPPYT00000005673
Sequence length 193
Comment pep:known chromosome:PPYG2:12:77343433:77409178:-1 gene:ENSPPYG00000004790 transcript:ENSPPYT00000005673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKS
CYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCS
RCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGF
GYGQGAGALVHAQ
Download sequence
Identical sequences A0A024RBB5 A0A0D9QVH9 A0A0R5Z2R2 A0A2K5CC93 A0A2K5J1D2 A0A2K5NDB4 A0A2K5QWL6 A0A2K5TM03 A0A2K6A3A2 A0A2K6BPP1 A0A2K6FQM1 A0A2K6JMW4 A0A2K6PDX1 F6TZP6 F7EGS6 G1QYA7 G1SUY3 G3S5C4 H2NI46 H9ENY8 I3MG97 K7AXD6 K9IYP6 L8IPC5 M3W637 Q16527 Q32LE9
ENSOCUP00000007197 9598.ENSPTRP00000008907 9600.ENSPPYP00000005460 9606.ENSP00000310901 9796.ENSECAP00000013345 9913.ENSBTAP00000017835 9986.ENSOCUP00000007197 ENSDNOP00000006793 ENSP00000310901 ENSP00000450056 ENSBTAP00000017835 ENSGGOP00000023280 ENSGGOP00000023802 gi|4503101|ref|NP_001312.1| ENSPPYP00000005460 ENSCJAP00000035560 NP_001033272.1.59421 NP_001033272.1.76553 NP_001287894.1.87134 NP_001287894.1.92137 NP_001312.1.87134 NP_001312.1.92137 XP_001489207.1.31192 XP_002711400.1.1745 XP_002752850.1.60252 XP_002823586.1.23681 XP_003259623.1.23891 XP_003259624.1.23891 XP_003313876.1.37143 XP_003778135.1.23681 XP_003832929.1.60992 XP_003832930.1.60992 XP_003989110.1.62641 XP_004006257.1.66739 XP_004053651.1.27298 XP_004053653.1.27298 XP_004417948.1.5094 XP_004473001.1.11602 XP_004473002.1.11602 XP_004473003.1.11602 XP_004473004.1.11602 XP_004602746.1.94378 XP_005330496.1.77405 XP_005571660.1.63531 XP_005571661.1.63531 XP_005893695.1.15283 XP_005976386.1.78601 XP_006073277.1.26621 XP_007088807.1.5354 XP_008002279.1.81039 XP_008002280.1.81039 XP_008524745.1.77740 XP_009002516.1.60252 XP_009002517.1.60252 XP_009002518.1.60252 XP_009424157.1.37143 XP_010360924.1.97406 XP_010360925.1.97406 XP_010832173.1.44457 XP_011725386.1.29376 XP_011725387.1.29376 XP_011819147.1.43180 XP_011819148.1.43180 XP_011819149.1.43180 XP_011836779.1.47321 XP_011836780.1.47321 XP_011905188.1.92194 XP_011905189.1.92194 XP_012005591.1.54773 XP_012005592.1.54773 XP_012005593.1.54773 XP_012029353.1.66739 XP_012029354.1.66739 XP_012297505.1.9421 XP_012503820.1.63892 XP_012503821.1.63892 XP_012605803.1.48125 XP_012605804.1.48125 XP_012605806.1.48125 XP_012605807.1.48125 XP_014202733.1.60992 XP_014919132.1.86478 XP_015007827.1.72884 XP_015007828.1.72884 XP_015338456.1.40921 XP_016054896.1.3490 XP_017386107.1.71028 XP_017386108.1.71028 XP_017728000.1.44346 XP_017728001.1.44346 XP_019310723.1.44245 XP_019508765.1.44202 XP_019610591.1.88060 XP_019610592.1.88060 XP_019815769.1.53367 XP_020741816.1.74333 XP_020741817.1.74333 XP_020741818.1.74333 XP_509232.3.37143 ENSECAP00000013345 ENSNLEP00000005928 ENSP00000310901 ENSP00000450056 ENSPPYP00000005460 ENSSARP00000002063 ENSOCUP00000007197 ENSECAP00000013345 ENSCJAP00000035560 ENSGGOP00000023280 ENSGGOP00000023802 ENSSARP00000002063 ENSBTAP00000017835 ENSFCAP00000006082 ENSNLEP00000005928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]