SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005520 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005520
Domain Number 1 Region: 180-194,283-323,378-591
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.37e-59
Family Nuclear receptor ligand-binding domain 0.0000955
Further Details:      
 
Domain Number 2 Region: 112-193
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-29
Family Nuclear receptor 0.0000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005520   Gene: ENSPPYG00000004840   Transcript: ENSPPYT00000005733
Sequence length 604
Comment pep:known chromosome:PPYG2:12:96164365:96219279:-1 gene:ENSPPYG00000004840 transcript:ENSPPYT00000005733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATIEEIAHQIIEQQMGEIVTEQQTGQKIQIVTALDHNTQGKQFILTNHDGSTPSKVILA
RQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSSPDQGPNKVFDLCVVCGDK
ASGRHYGAVTCEGCKGFFKRSIRKNLVYSCRGSKDCIINKHHRNRCQYCRLQRCIAFGMK
QDSVQCERKPIEVSREKSSNCAASTEKIYIRKDLRSPLTATPTFVTDSESTRSTGLLDSG
MFVNIHPSGVKTESTVLMTSDKAESCQGDLSTLASVVTSLANLGKTKDLSQNSNEMSMIE
SLSNDDTSLCEFQEMQTNGDVSRAFDTLAKALNPGESTACQSSVAGMEGSVHLITGDSSI
NYTEKEGPLLSDSHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQ
ENSISLVKAYWNELFTLGLAQCWQVMNVATILATFVNCLHNSLQQDKMSTERRKLLMEHI
FKLQEFCNSMVKLCIDGYEYAYLKAIVLFSPDHPGLENMEQIEKFQEKAYVEFQDYITKT
YPDDTYRLSRLLLRLPALRLMNATITEELFFKGLIGNIRIDSVIPHILKMEPADYNSQII
GHGI
Download sequence
Identical sequences H2NIA2
ENSPPYP00000005520 XP_009246386.1.23681 ENSPPYP00000005520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]