SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005555 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005555
Domain Number 1 Region: 249-474
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-60
Family Nuclear receptor ligand-binding domain 0.000000000902
Further Details:      
 
Domain Number 2 Region: 125-200
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.01e-27
Family Nuclear receptor 0.0000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005555   Gene: ENSPPYG00000004867   Transcript: ENSPPYT00000005769
Sequence length 475
Comment pep:known chromosome:PPYG2:12:101781136:101871007:1 gene:ENSPPYG00000004867 transcript:ENSPPYT00000005769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKMNLIEHSHLPTTDEFSFSENLFGVLTEQVAGPLGQNLEVEPYSQYSNVQFPQVQPQ
ISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVAEMPVTKKPRMGASAGR
IKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQ
ECRLRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTMNEDSEGRDLRQVTSTT
KSCREKTELTPDQQTLLRFIMDSYSKQRMPQEITNKILKEEFSAEENFLILTEMATNHVQ
VLVEFTKKLPGFQTLDHEDQIALLKGSAEAMFLCSAEIFNKKLPSGHSDLLEERIRNSGI
SDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQK
LCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ
Download sequence
Identical sequences H2NID7
9600.ENSPPYP00000005555 ENSPPYP00000005555 ENSPPYP00000005555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]