SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005725 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005725
Domain Number 1 Region: 294-356
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.31e-19
Family LIM domain 0.0024
Further Details:      
 
Domain Number 2 Region: 352-380
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000628
Family LIM domain 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000005725
Domain Number - Region: 278-297
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0342
Family LIM domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005725   Gene: ENSPPYG00000005023   Transcript: ENSPPYT00000005945
Sequence length 381
Comment pep:known chromosome:PPYG2:12:122388597:122445209:-1 gene:ENSPPYG00000005023 transcript:ENSPPYT00000005945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNG
TILDPLDQWQPSGSRFIHQQPQSSSPVYGSSAKTSSVSNPQDGVGSPCSRVGEEEHVYSF
PNKQKSAESSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPH
YGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQG
EMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKKVVTALDRTWHPEHFFCAQCGAF
FGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPF
VNGSFFEHDGQPYCEVPYHER
Download sequence
Identical sequences H2NIU9
ENSPPYP00000005725 ENSPPYP00000005725 9600.ENSPPYP00000005725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]