SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005908 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005908
Domain Number 1 Region: 229-276
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.14e-16
Family TRASH domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005908   Gene: ENSPPYG00000005187   Transcript: ENSPPYT00000006140
Sequence length 668
Comment pep:novel chromosome:PPYG2:13:18901513:18940443:-1 gene:ENSPPYG00000005187 transcript:ENSPPYT00000006140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKCSVGGLELTEQSPALLGNMAMATSLMDIGDSFGHPACPLVSRSRNSPVEDDDDDDVV
FIESIQPPSISAPAIADQSNFVFASSKNEKPQGNYSVIPPSSRDLASQKGNISETIVIDD
EEDIETNGGAEKNSSRFIEWGLPGTKNKTKDLDFSTSSLSRSKTKTGVRPFNPGRMNVAG
DLFQNGEFATHHSPDSWISQSASFPRNQKQPGVDSLSPVALLRKQNFQPTAQQQLTKRAK
ITCANCKKPLQKGQTAYQRKGSAHLFCSTTCLSSFSHKRTQNTRSIICKKDASTKKANVV
LPVESSKSFQEFCSTSCLSPCENNRNLKKGIFNKSRCTICSKLAEIRHEVSVNNVTHKLC
SNHCFNKYRLANGLIMNCCEHCGEYMPSKSTGNNILVFGGQQKIFCCQSCINEYKQMMET
KSKKLTASENRKRNAFREENEKQFCGSSNTLLKKIEGIPEKKEKTSQLQLSVECGTDTLL
IQENVNLPPSSTSTIADIFQEQLEEKNFEDCIVPVVLSADPGTWPRILNIKQRDTLVENV
PPQVRNFNFPKDNTGRKFSETYYTRILPNGEKTTRSWLLYSTSKDSVFCLYCKLFGEGKN
QLKNENGCKDWQHLSHILSKHEESEMHINNSVKYSKLKSDLKKNKAIDAAERRLYENEKN
DGVLLLYT
Download sequence
Identical sequences H2NJC0
ENSPPYP00000005908 ENSPPYP00000005908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]