SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006424 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006424
Domain Number 1 Region: 428-499
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000034
Family LIM domain 0.0073
Further Details:      
 
Domain Number 2 Region: 366-433
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000529
Family LIM domain 0.0084
Further Details:      
 
Domain Number 3 Region: 338-364
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000048
Family LIM domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006424   Gene: ENSPPYG00000005652   Transcript: ENSPPYT00000006679
Sequence length 538
Comment pep:known chromosome:PPYG2:14:22444859:22456094:-1 gene:ENSPPYG00000005652 transcript:ENSPPYT00000006679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERLGEKASRLLEKFGRRKGESSRSGSDGTPGPGKGRLSGLGGPRKSGPRGATGGPGDEP
LEPAREQGSLDAERNQRGSFEAPRYEGSFPGGPPPTRALPLPQSLPPDFRLEPTAPALSP
RSSFASSSASDASKPSSPRGSLLLDGAGAGGAGGSRPCSNRTSGISMGYDQRHGSPLPAG
PCLFGPPLAGAPAGYSPGGVPSAYPELHAALDRLYAQRPAGFGCQESRHSYPPALGSPGA
LAGAGVGAAGPLERRGAQPGRHSVTGYGDCAVGARYQDELTALLRLTVGTGGREAGARGE
PSGIEPSGLEEPPGPFVPEAARARMREPEAREDYFGTCIKCNKGIYGQSNACQALDSLYH
TQCFVCCSCGRTLRCKAFYSVNGSVYCEEDYLFSGFQEAAEKCCVCGHLILEKILQAMGK
SYHPGCFRCIVCNKCLDGIPFTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGCEDIV
RVISMDRDYHFECYHCEDCRMQLSDEEGCCCFPLDGHLLCHGCHMQRLNARQPPANYI
Download sequence
Identical sequences H2NKR2
ENSPPYP00000006424 ENSPPYP00000006424 XP_002824617.1.23681 9600.ENSPPYP00000006424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]