SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006703 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006703
Domain Number 1 Region: 263-499
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.6e-63
Family Nuclear receptor ligand-binding domain 0.000000000726
Further Details:      
 
Domain Number 2 Region: 148-226
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.4e-26
Family Nuclear receptor 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006703   Gene: ENSPPYG00000005896   Transcript: ENSPPYT00000006966
Sequence length 531
Comment pep:known chromosome:PPYG2:14:65128458:65179753:-1 gene:ENSPPYG00000005896 transcript:ENSPPYT00000006966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIKNSPSSLNSPSSYNCSQSVLPLEHGSIYIPSSYVESHHEYPAMTFYSPAVMNYSIPS
NVTNLEGGGPGRQTTSPNVLWPTPGHLSPLAVHRQLSHLYAEPQKSPWCEARSLEHTLPV
NRETLKRKVSGNHCASPVTGPSSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQG
HNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQL
HCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLT
KLADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMVGLMWRSIDHPGKLIFAPD
LVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVAATQD
ADSSRKLAHLLNAMTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLSM
KCKNVVPVYDLLLEMLNAQVLRGCKSSITGSECSPAEDSRSKEGSQNPQSQ
Download sequence
Identical sequences H2NLH9
9600.ENSPPYP00000006703 ENSPPYP00000006703 XP_002824882.1.23681 ENSPPYP00000006703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]