SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006792 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006792
Domain Number 1 Region: 752-800
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000017
Family Myb/SANT domain 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000006792
Domain Number - Region: 950-983
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000986
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006792   Gene: ENSPPYG00000005975   Transcript: ENSPPYT00000007060
Sequence length 1022
Comment pep:novel chromosome:PPYG2:14:74874747:74921123:-1 gene:ENSPPYG00000005975 transcript:ENSPPYT00000007060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLQAQPKAQNKRKRCLFGGQEPAPKEQPPPLQPPQQSIRVKEEQYVGHEGPGGAVSTSQ
PVELPPPSSLALLNSVVYGPERTSAAMLSQQVASVKWPNSVMAPGRGPERGGGGGVSDSS
WQQQPGQPPPHSTWNCHSLSLYSAPKGSPHPGVGVPTYYNHPEALKREKAGGPQLDRYVR
PMMPQKMQLEVGRPQAPLNSFHAAKKPPNQSLPLQPFQLAFGHQVNRQVFRQGPPPPNPV
AAFPPQKQQQQQQPQQQQQQQQAALPQMPLFENFYSMSQQPSQQPQDFGLQPAGPLGQSH
LAHHSMAPYPFPSNPDMNPELRKALLQESAPQPALPQVQIPFPRRSRRLSKEGILPPTAL
DGAGTQPGQEPTGNLFLHHWPLQQPPPGSLGQPHPEALGFPLELRESQLLPDGERLAPNG
REREAPAMGNEEGMRAVSTGDCGQVLRGGVIQSTRRRRRASQEANLLTLAQKAVELASLQ
NAKDGSGSEEKRKSVLASTTKCGVEFSEPSLATKRAREDSGMIPLIIPVSVPVRTVDPTE
AAQAGGLDEDGKGPEQNPAEHKPSVIVTRRRSTRIPGTDAPAQVREGFGFYFNAIISTST
IPAPPPITPKSVHCMLLRTNSAEVTPPVLSVMGEATPVSIEPRINVGSRFQAEIPLMRDR
ALAAADPHKADLVWQPWEDLESSREKQRQVEDLLTAACSSIFPGAGTNQELALHCLHESR
GDILETLNKLLLKKPLRPHNHPLATYHYTGSDQWKMAERKLFNKGIAIYKKDFFLVQKLI
QTKTVAQCVEFYYTYKKQVKIGRNGTLTFGDVDTSDEKSAQEDVEVDIKTSQKFPRVPLP
RRESPSEERLEPKREVKESRKEGEEEVPEIQEKEEQEEGRERSRRAAAVKATQTLQANES
ASDILILRSHESNAPGSAGGQASEKPREGTGKSRRALPFSEKKKKTETFSKTQNQENTFP
CKKCGRVFYKVKSRSAHMKSHAEQEKKAAALRLKEKEAAAAAAAAHQQALREESGVGAGD
KG
Download sequence
Identical sequences H2NLR2
ENSPPYP00000006792 ENSPPYP00000006792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]