SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006838 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006838
Domain Number 1 Region: 179-437
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.06e-74
Family Nuclear receptor ligand-binding domain 0.0000000106
Further Details:      
 
Domain Number 2 Region: 105-191
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-30
Family Nuclear receptor 0.00000657
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006838   Gene: ENSPPYG00000006012   Transcript: ENSPPYT00000007107
Sequence length 438
Comment pep:novel chromosome:PPYG2:14:77487649:77681200:1 gene:ENSPPYG00000006012 transcript:ENSPPYT00000007107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLNRMSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANG
LDSPPMFAGTGLGGTPCRKSYEDCASGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHY
GVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRL
DRVRGGRQKYKRRLDSESSPYLSLQISPPAKKPLTKIVSYLLVAEPDKLYAMPPPGMPEG
DIKALTTLCDLADRELVVIIGWAKHIPGFSNLSLGDQMSLLQSAWMEILILGIVYRSLPY
DDKLVYAEDYIMDEEHSRLTGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALANSDSM
YIEDLEAVQKLQDLLHEALQDYELSQRHEEPRRTGKLLLTLPLLRQTAAKAVQHFYSVKL
QGKVPMHKLFLEMLEAKV
Download sequence
Identical sequences H2NLV4
ENSPPYP00000006838 ENSPPYP00000006838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]