SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007052 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007052
Domain Number 1 Region: 268-320
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000217
Family Myb/SANT domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000007052
Domain Number - Region: 369-412
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0135
Family Erythroid transcription factor GATA-1 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007052   Gene: ENSPPYG00000006208   Transcript: ENSPPYT00000007333
Sequence length 697
Comment pep:novel chromosome:PPYG2:14:107218006:107252976:1 gene:ENSPPYG00000006208 transcript:ENSPPYT00000007333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSLSEALYSPDGRSRGTPSACCLLLSLSSDYVYFENSSSNPYLIRRIEELNKTANGNV
EAKVVCFYRRRDISSTLIALADKHATLSVCYKAGPGADNGEKGEIEEEMENPEMVDLPEK
LKHQLRHRELFLSRQLESLPATHIRGKCSVTLLNETESLKSYLEREEEDGRDQSKLETKV
WEAHNPLTDKQIDQFLVVARSVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTL
HKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEALEKYGKDFTDIQQDFLPWK
SLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYNKPNPNQISVNNVKAGVVN
GTGAPGQSPGAGRACESCYTTQSYQWYSWGPPNMQCRLCASCWTYWKKYGGLKMPTRLDG
ERPGPNRSNMSPHGLPARSSGSPKFAMKTRQAFYLHTTKLTRIARRLCREILRPWHAARH
PYLPINSAAIKAECTARLPEASQSPLVLKQAVRKPLEAVLRYLETHPRPPKPDPVKSVSS
VLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGLANHGQTRHMGPS
RNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETK
RAARRPYKPIALRQSQALPLRPPPPAPVNDEPIVIED
Download sequence
Identical sequences H2NMG1
ENSPPYP00000007052 ENSPPYP00000007052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]