SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007053 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007053
Domain Number 1 Region: 16-61
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.42e-16
Family LIM domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007053   Gene: ENSPPYG00000006209   Transcript: ENSPPYT00000007334
Sequence length 63
Comment pep:known chromosome:PPYG2:14:107271315:107271653:1 gene:ENSPPYG00000006209 transcript:ENSPPYT00000007334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERVTSLGKDWHRPCVKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESH
TFK
Download sequence
Identical sequences H2NMG2
ENSPPYP00000007053 ENSPPYP00000007053 9600.ENSPPYP00000007053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]