SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007132 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000007132
Domain Number - Region: 836-864
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000101
Family A20-like zinc finger 0.026
Further Details:      
 
Domain Number - Region: 26-63
Classification Level Classification E-value
Superfamily UBA-like 0.000357
Family TAP-C domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007132   Gene: ENSPPYG00000006293   Transcript: ENSPPYT00000007428
Sequence length 869
Comment pep:known chromosome:PPYG2:15:27378151:27542019:-1 gene:ENSPPYG00000006293 transcript:ENSPPYT00000007428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSVLPNPTSAECWAALLHDPMTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDLTAAL
SDYEQLRQVHTANLPHVFNEGRGPKQPEREPQPGHKVERPCLQRQDDIAQEKRLSRGISH
ASSAIVSLARSHVASECNNEQFPLEMPIYTFQLPDLSVYSEDFRSFIERDLIEQATMVAL
EQAGRLNWWSTVCTSCKRLLPLATTGDGNCLLHAASLGMWGFHDRDLVLRKALYTMMRTG
AEREALKRRWRWQQTQQNKESGLVYTEEEWEREWTELLKLASSEPRTHFSKNGGTGGGVD
NSEDPVYESLEEFHVFVLAHILRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPPNR
CHCSPLVLAYDQAHFSALVSMEQRDQQREQAVIPLTDSEHKLLPLHFAVDPGKDWEWGKD
DNDNARLAHLILSLEAKLNLLHSYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLADS
LDSDRDSVCSNSNSNNGKNGKDKEKEKQRKEKDKTRADSVANKLGSFSKTLGIKLKKNMG
GLGGLVHGKMGRANSANGKNGDSAERGKEKKAKSRKGSKEESGASASTSPSEKTTPSPTD
KAAGASPAEKGGGPRGDAWKYSTDVKLSLNILRAAMQGERKFIFAGLLLTSHRHQFHKEM
IGYYLTSAQERFSAEQEQRRRYAATAAAAAAAAAAAAAAASTAKRPPRRPETEGAPVPER
ASPGPPTQLVLKLKERPSPGPAAGRAARAAAGGTASSGGGARRGAAIGLVPGRSPPAPAR
QSVIHVHASGARDEACAPAVGALRSFSKYPQQNRSLSSQSYCPARAAALQRRYQLENCAL
YGRAETEHYCSYCYREELRRRREARGARP
Download sequence
Identical sequences H2NMN8
ENSPPYP00000007132 ENSPPYP00000007132 9600.ENSPPYP00000007132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]