SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007402 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007402
Domain Number 1 Region: 304-543
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.42e-70
Family Nuclear receptor ligand-binding domain 0.000000000647
Further Details:      
 
Domain Number 2 Region: 102-187
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-31
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007402   Gene: ENSPPYG00000006528   Transcript: ENSPPYT00000007706
Sequence length 555
Comment pep:known chromosome:PPYG2:15:57422545:57558608:-1 gene:ENSPPYG00000006528 transcript:ENSPPYT00000007706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEGAPGDSDLETEARVPWSITGHCLTGQARMSATPTPAGEGARRDELFGILQILHQCIL
SSGDAFVLTGVCCSWRQNGKPPYSQKEDKEVQTGYMNSQIEIIPCKICGDKSSGIHYGVI
TCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRM
SKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHT
PEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTV
SMAELEHLAQNISKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKIT
EAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASP
DVFKSLGCEDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSADRSWLQEKVKIEKLQQK
IQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYK
ELFTSEFEPAMQIDG
Download sequence
Identical sequences H2NNE5
ENSPPYP00000007402 9600.ENSPPYP00000007402 ENSPPYP00000007402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]