SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007493 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007493
Domain Number 1 Region: 26-322
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-64
Family Nuclear receptor ligand-binding domain 0.0000313
Further Details:      
 
Domain Number 2 Region: 2-35
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000123
Family Nuclear receptor 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007493   Gene: ENSPPYG00000006608   Transcript: ENSPPYT00000007797
Sequence length 322
Comment pep:novel chromosome:PPYG2:15:69137896:69146645:1 gene:ENSPPYG00000006608 transcript:ENSPPYT00000007797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVRLDSMESNTERRPESLVA
PPAPAGPSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSP
YSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSGLPFRDQVILLEEAWSELFLLGAIQW
SLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLRETISRFRALAVDPTEFACMKALVL
FKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIEL
LFFRKTIGNTPMEKLLCDMFKN
Download sequence
Identical sequences H2NNN1
ENSPPYP00000007493 ENSPPYP00000007493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]