SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007617 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007617
Domain Number 1 Region: 129-203
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 2.62e-30
Family AN1-like Zinc finger 0.0000737
Further Details:      
 
Domain Number 2 Region: 13-63
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000138
Family A20-like zinc finger 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007617   Gene: ENSPPYG00000006712   Transcript: ENSPPYT00000007926
Sequence length 208
Comment pep:known chromosome:PPYG2:15:77569169:77654604:1 gene:ENSPPYG00000006712 transcript:ENSPPYT00000007926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSE
SLPVQCTDGSVPEAQSTLDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDKAVPETEDL
QASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHN
CSYNYKADAAEKIRKENPVVVGEKIQKI
Download sequence
Identical sequences A0A2J8SKJ8 Q5R7S6
ENSPPYP00000007617 9600.ENSPPYP00000007617 ENSPPYP00000007617 NP_001127520.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]