SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007715 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007715
Domain Number 1 Region: 124-356
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-51
Family Nuclear receptor ligand-binding domain 0.0002
Further Details:      
 
Domain Number 2 Region: 76-150
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.08e-25
Family Nuclear receptor 0.0000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007715   Gene: ENSPPYG00000006802   Transcript: ENSPPYT00000008030
Sequence length 377
Comment pep:novel chromosome:PPYG2:15:93286944:93294449:1 gene:ENSPPYG00000006802 transcript:ENSPPYT00000008030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAASGQ
GGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRN
CPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSG
YISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD
QVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVE
KLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCAWKNTLGASTPTSRRDS
ESFCFASLPSAPSPPQS
Download sequence
Identical sequences H2NP93
ENSPPYP00000007715 ENSPPYP00000007715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]